PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09407.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 189aa    MW: 21409.5 Da    PI: 9.0194
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09407.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-171360148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W+ +Ed++l+d+++++G g+W++ ++  g++R++k+c++rw +yl
  mrna09407.1-v1.0-hybrid 13 KGAWSIQEDQKLIDYIQKHGEGCWNSLPKAAGLRRCGKSCRLRWINYL 60
                             79********************************************97 PP

2Myb_DNA-binding569.1e-1866111148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++++E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  mrna09407.1-v1.0-hybrid  66 RGSFSEDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111
                              899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-24463IPR009057Homeodomain-like
PROSITE profilePS5129415.033860IPR017930Myb domain
SMARTSM007171.1E-111262IPR001005SANT/Myb domain
SuperFamilySSF466892.27E-2912107IPR009057Homeodomain-like
PfamPF002491.1E-151360IPR001005SANT/Myb domain
CDDcd001671.43E-91560No hitNo description
PROSITE profilePS5129427.56461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2664115IPR009057Homeodomain-like
SMARTSM007173.0E-1765113IPR001005SANT/Myb domain
PfamPF002491.6E-1666111IPR001005SANT/Myb domain
CDDcd001672.47E-1268111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MRKPCCEKTE TTKGAWSIQE DQKLIDYIQK HGEGCWNSLP KAAGLRRCGK SCRLRWINYL  60
RPDLKRGSFS EDEEDLIIRL HKLLGNRWSL IAGRLPGRTD NEVKNYWNSH LKKKILNTGT  120
TLRPNKPRPE IKHAPYNKLV KYFNEMDDEV VDEVSSADSA AGCLVPELNL DLTLSIKTST  180
GMADPQVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-301011524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4012200.0AF401220.1 Fragaria x ananassa transcription factor MYB1 (MYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299542.11e-139PREDICTED: transcription factor MYB3-like
SwissprotQ388511e-67MYB6_ARATH; Transcription repressor MYB6
SwissprotQ9S9K93e-67MYB3_ARATH; Transcription factor MYB3
SwissprotQ9SZP15e-67MYB4_ARATH; Transcription repressor MYB4
TrEMBLE7BLK11e-129E7BLK1_9R
TrEMBLQ94EN31e-129Q94EN3_FRAAN; Transcription factor MYB1
STRINGPOPTR_0010s12420.14e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.14e-68myb domain protein 6